PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010529976.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 353aa    MW: 38332.7 Da    PI: 7.9759
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010529976.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.62.8e-1394138347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ qky
   XP_010529976.1  94 PWTEEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKY 138
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.71387143IPR017930Myb domain
SuperFamilySSF466892.39E-1789144IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-1890142IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.0E-1191138IPR009057Homeodomain-like
SMARTSM007175.0E-1191141IPR001005SANT/Myb domain
PfamPF002496.6E-1194138IPR001005SANT/Myb domain
CDDcd001672.50E-994139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MTRRCSHCNL NGHNSRTCPN RGVKLFGVRL TEGSIRKSAS MGNLSHYAGG HSGTGSNYPG  60
SPGDTPDHAA GDGYASEDFV SGPSSSRERK KGTPWTEEEH RMFLLGLQKL GKGDWRGISR  120
NYVTTRTPTQ VASHAQKYFM RQSNVSRRKR RSSLFDMVPD EISDVPMEPQ LVNCHTETQI  180
QGNDPLPVLP PAPVPVIAPS IPRTEECESM DSTKSSTGEP PMAAATASSS SKAEENKPLQ  240
LPASFPVLYP TYFSPFSSFP VPIWPAVGYI PEPAQKEEVH EIHRPRAVHS KAPINVDELL  300
GISKLTLGES IRDSEQSRSL TLTGGSSSSS RQSAFHPNPA SDSSDMNSPI HAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010529976.10.0PREDICTED: protein REVEILLE 8-like
TrEMBLR0EUD41e-179R0EUD4_9BRAS; Uncharacterized protein
STRINGAT5G47390.11e-175(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34262759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-163MYB_related family protein